diff options
| -rw-r--r-- | DogCV.png | bin | 0 -> 137761 bytes | |||
| -rw-r--r-- | PCV2.jpg | bin | 0 -> 15688 bytes | |||
| -rw-r--r-- | index.html | 93 |
3 files changed, 88 insertions, 5 deletions
diff --git a/DogCV.png b/DogCV.png Binary files differnew file mode 100644 index 0000000..e99c808 --- /dev/null +++ b/DogCV.png diff --git a/PCV2.jpg b/PCV2.jpg Binary files differnew file mode 100644 index 0000000..f3c6a19 --- /dev/null +++ b/PCV2.jpg @@ -43,6 +43,39 @@ div.tab button.active { width: 80%; min-height: 250px; } +#carousel{ + overflow: hidden; + width: 500px; + height: 333px; + border: 1px solid #333; +} + +.panels{ + margin: 0; + padding: 0; +} + +.panel{ + float: left; + list-style: none; + margin: 0; + padding: 0; +} +.panel img{ +} + +figure { + float: right; + width: 30%; + text-align: center; + font-size: smaller; + text-indent: 0; + margin: 0.5em; + padding: 0.5em; +} +img.scaled { + width: 100%; +} </style> </head> <body> @@ -50,11 +83,12 @@ div.tab button.active { <p>Welcome to CRESSdna.org</p> <div class="tab"> - <button class="tablinks" onclick="openTab(event, 'Home')" id="defaultOpen">Home</button> - <button class="tablinks" onclick="openTab(event, 'Taxonomy')">Taxonomy</button> + <button class="tablinks" onclick="openTab(event, 'Home')" id="defaultOpen"class>Home</button> + <button class="tablinks" onclick="openTab(event, 'Circoviridae')"><i>Circoviridae</i></button> + <button class="tablinks" onclick="openTab(event, 'Classifier')">Classifier</button> <button class="tablinks" onclick="openTab(event, 'Contact')">Contact</button> <button class="tablinks" onclick="openTab(event, 'Results')">Results</button> - </div> +</div> <div id="Home" class="tabcontent"> <h3>Home</h3> @@ -62,8 +96,57 @@ div.tab button.active { <img src='nsf1.jpg' alt='Sponsored with a Grant from the National Science Foundation'> </div> -<div id="Taxonomy" class="tabcontent"> - <h3>Taxonomy</h3> + +<div id="Circoviridae" class="tabcontent"> + <h3><i>Circoviridae</i></h3> + +<p> +<br> +Many animal-infecting CRESS-DNA viruses are classified into the <a href="http://jgv.microbiologyresearch.org/content/journal/jgv/10.1099/jgv.0.000871"><i>Circoviridae</i> family</a>. There are two genera within the group, the older <i>Circovirus</i> and the more recently codified <i>Cyclovirus</i>, but both are well represented. At least one disease of economic importance is associated with circovirus infections: <a href="https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3652492/">post-weaning maturation wasting syndrome</a> in pigs (caused in part by porcine circovirus 2, which is now largely controlled through <a hfref="https://www.ncbi.nlm.nih.gov/pubmed/27769529">vaccination in commercial hog production</a>). However, several worldwide veterinary diseases are due to circoviruses, including <a href="https://en.wikipedia.org/wiki/Psittacine_beak_and_feather_disease">beak and feather disease</a> and <a href="https://www.ncbi.nlm.nih.gov/pubmed/28242782">fatal acute diarrhea</a> in dogs. +</p> + +<figure> + <img class=scaled src="../DogCV.png", alt='missing' /> + <figcaption><a href="https://wwwnc.cdc.gov/eid/article/19/4/12-1390-f2">Gastrointestinal system of dogs infected with dog circovirus</a> (DogCV) with hemorrhaging in stomach and intestines. CC-BY Li et al. 2013</figcaption> +</figure> + +<figure> + <img class=scaled src="../PCV2.jpg", alt='missing' /> + <figcaption><a href="https://virologyj.biomedcentral.com/articles/10.1186/1743-422X-8-291">Immune electron microscopy image of PCV2</a> (porcine circovirus 2) particles. CC-BY Guo et al. 2011</figcaption> +</figure> + +<p> +While some of the environmental isolates assigned to <i>Circoviridae</i> have genomes over 3,000 and 4,000 bases, it also contains some of the smallest genomes of CRESS-DNA viruses – some well-studied circoviruses have genomes ~1700nt long, and circularized putative genomes from metagenomics studies can be even smaller. Most analyzed sequences have two ORFs: the replication-associated protein (Rep, also referred to as the replication initiator protein) and capsid protein (Cp or Cap), with some isolates having had a third ORF experimentally verified, and some sequences having many hypothetical ORFs called that have not yet been studied in the lab. +</p> + +<p> +Both cycloviruses and circoviruses have non-enveloped, icosahedral virions of 15-25nm encapsidating their circular, ssDNA genomes, but while members of <i>Circovirus</i> are found infecting or associated with mammals, birds and fish, cycloviruses have been found infecting or associated with mammals, birds and insects. Sequences assigned to <i>Circovirus</i> have ambisense genomes, with the Rep gene in sense, sequences in Cyclovirus typically are ambisense in the opposite orientation (Rep gene in anti-senese). +</p> + +<p> +A great <a href="http://jgv.microbiologyresearch.org/content/journal/jgv/10.1099/jgv.0.000871">primer</a> on <i>Circoviridae</i> +</p> + +<p> +For more information about <i>Circovirus</i>: +<br> +<a href="https://talk.ictvonline.org/ictv-reports/ictv_online_report/ssdna-viruses/w/circoviridae/659/genus-circovirus">ICTV report</a> on circovirus<br> +<a href="https://viralzone.expasy.org/118">ExPASy ViralZone summary of circovirus</a> +Type species: <i>Porcine circovirus</i> 1 (<a href="https://www.ncbi.nlm.nih.gov/nuccore/12280941">NC_001792.2</a>) +</p> + +<p> +FOr more information about <i>Cyclovirus</i>: +<br> +<a href="https://talk.ictvonline.org/ictv-reports/ictv_online_report/ssdna-viruses/w/circoviridae/660/genus-cyclovirus">ICTV report</a> on cyclovirus<br> +<a href="https://viralzone.expasy.org/7296">ExPASy ViralZone summary of cyclovirus</a> +Type species: <i>Human-associated cyclovirus 8</i> (<a href="https://www.ncbi.nlm.nih.gov/nuccore/KF031466">KF031466</a>) + + +</div> + +<div id="Classifier" class="tabcontent"> + <h3>Classifier</h3> <form action="./bin/classifier.py" method="post"><br> <textarea rows="4" cols="50" name="fasta" input type="submit">>Demo MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI</textarea> |
