From 228f8f203eac1b5881d890e266ac10d46bb1b024 Mon Sep 17 00:00:00 2001 From: elavington Date: Thu, 27 Jul 2017 15:33:17 -0400 Subject: Add files via upload --- CRESSdna.html | 156 ++++++++++++++++++++++++++++++++ CRESSresults.html | 51 +++++++++++ cgi-bin/SVM_linear_aa_clf.pkl | Bin 0 -> 187597 bytes cgi-bin/UniqRepsGemys_6089_StSCALER.pkl | Bin 0 -> 980 bytes cgi-bin/classifier.py | 52 +++++++++++ 5 files changed, 259 insertions(+) create mode 100644 CRESSdna.html create mode 100644 CRESSresults.html create mode 100644 cgi-bin/SVM_linear_aa_clf.pkl create mode 100644 cgi-bin/UniqRepsGemys_6089_StSCALER.pkl create mode 100644 cgi-bin/classifier.py diff --git a/CRESSdna.html b/CRESSdna.html new file mode 100644 index 0000000..a97d1c1 --- /dev/null +++ b/CRESSdna.html @@ -0,0 +1,156 @@ + + + + + + + + +

Welcome to CRESSdna.org

+ +
+ + + + +
+ +
+

Home

+

Part of the National Science Foundation's Assembling the Tree of Life.

+ Sponsored with a Grant from the National Science Foundation +
+ +
+

Taxonomy

+

Please enter only one word as the name(no space) and only one Rep sequence

+

+
+ +
+ + +
+

+

+
+ + +
+

Contact

+

Questions or comments? Send us an email:

+

email At domain Dot something

+
+ +
+

Results

+

Results from Taxonomy prediction

+
+ + + + + diff --git a/CRESSresults.html b/CRESSresults.html new file mode 100644 index 0000000..8a78bcd --- /dev/null +++ b/CRESSresults.html @@ -0,0 +1,51 @@ + + + + + + + + +

Taxonomy Prediction Results

+

Results as Name, predicted Genus, length of sequence:


+

+

This classifier will return the best fit of the submitted sequence to the training data.
+Currently included in the training data:
+

  • Circoviridae
  • + +
  • Nanoviridae
  • + +
  • Genomoviridae
  • + +
  • Geminiviridae
  • + +
  • Smacovirus
  • + + Return to CRESSdna.org +

    + + + + diff --git a/cgi-bin/SVM_linear_aa_clf.pkl b/cgi-bin/SVM_linear_aa_clf.pkl new file mode 100644 index 0000000..1afce0a Binary files /dev/null and b/cgi-bin/SVM_linear_aa_clf.pkl differ diff --git a/cgi-bin/UniqRepsGemys_6089_StSCALER.pkl b/cgi-bin/UniqRepsGemys_6089_StSCALER.pkl new file mode 100644 index 0000000..3a098bd Binary files /dev/null and b/cgi-bin/UniqRepsGemys_6089_StSCALER.pkl differ diff --git a/cgi-bin/classifier.py b/cgi-bin/classifier.py new file mode 100644 index 0000000..ec2b634 --- /dev/null +++ b/cgi-bin/classifier.py @@ -0,0 +1,52 @@ +#!/usr/bin/python + +#import packages to be used +from sklearn.svm import SVC +from sklearn.feature_extraction.text import CountVectorizer +from sklearn.preprocessing import StandardScaler +from sklearn.externals import joblib +import cgi, cgitb + +cgitb.enable() +form=cgi.FieldStorage() +if form.getvalue('fasta'): + alignment = form.getvalue('fasta') + alignment=[alignment] + name=form.getvalue('seqname') + size=len(alignment[0]) +else: + alignment = ["MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI"] + name='demo' + size=len(alignment[0]) + +html = open("./www.html/CRESSresults.html") +page=html.read() + + +AAs=['a','c','d','e','f','g','h','i','k','l','m','n','p','q','r','s','t','v','w','y'] +clf=joblib.load("./cgi-bin/SVM_linear_aa_clf.pkl") +StSc=joblib.load("./cgi-bin/UniqRepsGemys_6089_StSCALER.pkl") +cv=CountVectorizer(analyzer='char',ngram_range=(1,1),vocabulary=AAs) + + +#initialize text data vectorizer + +dataVect=cv.transform(alignment) + +#Scale the data to the training set +X=StSc.transform(dataVect.astype("float64")) + +#make predictions for the original dataset +results=",".join([name,clf.predict(X)[0]]) +results=",".join([results,str(size)]) +#for i in results: + #print(i[0],"\t",i[1]) + +output = page.format(prediction=results) +"""f=open('test.html','w') +f.write(output) +f.close()""" +print (output) + + +quit() \ No newline at end of file -- cgit v1.3 From e73bbde58c22e50cb77b2e8b0eb2193dc55fd8fa Mon Sep 17 00:00:00 2001 From: elavington <27739361+elavington@users.noreply.github.com> Date: Mon, 7 Aug 2017 09:35:07 -0400 Subject: Rename index.html to index_placeholder.html --- index.html | 12 ------------ index_placeholder.html | 12 ++++++++++++ 2 files changed, 12 insertions(+), 12 deletions(-) delete mode 100644 index.html create mode 100644 index_placeholder.html diff --git a/index.html b/index.html deleted file mode 100644 index 2957612..0000000 --- a/index.html +++ /dev/null @@ -1,12 +0,0 @@ - - - - CRESSDNA - - - -

    Circular Rep-Encoding Single Stranded DNA Viruses

    -

    Part of the National Science Foundation's Assembling the Tree of Life.

    - Sponsored with a Grant from the National Science Foundation - - diff --git a/index_placeholder.html b/index_placeholder.html new file mode 100644 index 0000000..2957612 --- /dev/null +++ b/index_placeholder.html @@ -0,0 +1,12 @@ + + + + CRESSDNA + + + +

    Circular Rep-Encoding Single Stranded DNA Viruses

    +

    Part of the National Science Foundation's Assembling the Tree of Life.

    + Sponsored with a Grant from the National Science Foundation + + -- cgit v1.3 From 44b05977b9cdd1d7c66f52cb81f988177d4ec391 Mon Sep 17 00:00:00 2001 From: elavington <27739361+elavington@users.noreply.github.com> Date: Mon, 7 Aug 2017 09:36:08 -0400 Subject: Rename CRESSdna.html to index.html --- CRESSdna.html | 156 ---------------------------------------------------------- index.html | 156 ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ 2 files changed, 156 insertions(+), 156 deletions(-) delete mode 100644 CRESSdna.html create mode 100644 index.html diff --git a/CRESSdna.html b/CRESSdna.html deleted file mode 100644 index a97d1c1..0000000 --- a/CRESSdna.html +++ /dev/null @@ -1,156 +0,0 @@ - - - - - - - - -

    Welcome to CRESSdna.org

    - -
    - - - - -
    - -
    -

    Home

    -

    Part of the National Science Foundation's Assembling the Tree of Life.

    - Sponsored with a Grant from the National Science Foundation -
    - -
    -

    Taxonomy

    -

    Please enter only one word as the name(no space) and only one Rep sequence

    -

    -
    - -
    - - -
    -

    -

    -
    - - -
    -

    Contact

    -

    Questions or comments? Send us an email:

    -

    email At domain Dot something

    -
    - -
    -

    Results

    -

    Results from Taxonomy prediction

    -
    - - - - - diff --git a/index.html b/index.html new file mode 100644 index 0000000..a97d1c1 --- /dev/null +++ b/index.html @@ -0,0 +1,156 @@ + + + + + + + + +

    Welcome to CRESSdna.org

    + +
    + + + + +
    + +
    +

    Home

    +

    Part of the National Science Foundation's Assembling the Tree of Life.

    + Sponsored with a Grant from the National Science Foundation +
    + +
    +

    Taxonomy

    +

    Please enter only one word as the name(no space) and only one Rep sequence

    +

    +
    + +
    + + +
    +

    +

    +
    + + +
    +

    Contact

    +

    Questions or comments? Send us an email:

    +

    email At domain Dot something

    +
    + +
    +

    Results

    +

    Results from Taxonomy prediction

    +
    + + + + + -- cgit v1.3 From ced7b0fadf5f113e6e040a1e97e7199a2cc65e05 Mon Sep 17 00:00:00 2001 From: elavington <27739361+elavington@users.noreply.github.com> Date: Mon, 7 Aug 2017 09:36:41 -0400 Subject: Update CRESSresults.html --- CRESSresults.html | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/CRESSresults.html b/CRESSresults.html index 8a78bcd..09c552a 100644 --- a/CRESSresults.html +++ b/CRESSresults.html @@ -43,7 +43,7 @@ Currently included in the training data:
  • Smacovirus
  • - Return to CRESSdna.org + Return to CRESSdna.org

    -- cgit v1.3 From f1528dc908f0ebc97f2d3864db57ee8417cfccb4 Mon Sep 17 00:00:00 2001 From: elavington <27739361+elavington@users.noreply.github.com> Date: Mon, 7 Aug 2017 09:38:22 -0400 Subject: Update classifier.py --- cgi-bin/classifier.py | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/cgi-bin/classifier.py b/cgi-bin/classifier.py index ec2b634..8f8450b 100644 --- a/cgi-bin/classifier.py +++ b/cgi-bin/classifier.py @@ -1,4 +1,4 @@ -#!/usr/bin/python +#!/home/erik/bin/python3.6 #import packages to be used from sklearn.svm import SVC @@ -49,4 +49,4 @@ f.close()""" print (output) -quit() \ No newline at end of file +quit() -- cgit v1.3 From f7d7849fcd6ce02a59db8c5fadc29d1962476493 Mon Sep 17 00:00:00 2001 From: elavington <27739361+elavington@users.noreply.github.com> Date: Wed, 9 Aug 2017 14:34:42 -0400 Subject: Delete index_placeholder.html could not create file on server via pull request --- index_placeholder.html | 12 ------------ 1 file changed, 12 deletions(-) delete mode 100644 index_placeholder.html diff --git a/index_placeholder.html b/index_placeholder.html deleted file mode 100644 index 2957612..0000000 --- a/index_placeholder.html +++ /dev/null @@ -1,12 +0,0 @@ - - - - CRESSDNA - - - -

    Circular Rep-Encoding Single Stranded DNA Viruses

    -

    Part of the National Science Foundation's Assembling the Tree of Life.

    - Sponsored with a Grant from the National Science Foundation - - -- cgit v1.3