From 47b146536121acc6ac8e3d847be2152500fe3167 Mon Sep 17 00:00:00 2001
From: Brian Cully <bjc@kublai.com>
Date: Fri, 22 Sep 2017 17:12:26 -0400
Subject: Fixup various CGI problems.

  * Rename cgi-bin to bin, to bypass default cgi-bin alias.
  * Change assignment to equality check in classifier.
  * Add .htaccess file to bin dir to allow CGI execution.
  * Point index.html form to bin.
---
 index.html | 2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

(limited to 'index.html')

diff --git a/index.html b/index.html
index b90789a..6fbf4a8 100644
--- a/index.html
+++ b/index.html
@@ -64,7 +64,7 @@ div.tab button.active {
 
 <div id="Taxonomy" class="tabcontent">
   <h3>Taxonomy</h3>
-  <form action="./cgi-bin/classifier.py" method="post"><br>
+  <form action="bin/classifier.py" method="post"><br>
 	<textarea rows="4" cols="50" name="fasta" input type="submit">
 >Demo
 MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI</textarea>
-- 
cgit v1.2.3