Home

Part of the National Science Foundation's Assembling the Tree of Life.

Circoviridae

Many animal-infecting CRESS-DNA viruses are classified into the Circoviridae family. There are two genera within the group, the older Circovirus and the more recently codified Cyclovirus, but both are well represented. At least one disease of economic importance is associated with circovirus infections: post-weaning maturation wasting syndrome in pigs (caused in part by porcine circovirus 2, which is now largely controlled through vaccination in commercial hog production). However, several worldwide veterinary diseases are due to circoviruses, including beak and feather disease and fatal acute diarrhea in dogs.

While some of the environmental isolates assigned to Circoviridae have genomes over 3,000 and 4,000 bases, it also contains some of the smallest genomes of CRESS-DNA viruses – some well-studied circoviruses have genomes ~1700nt long, and circularized putative genomes from metagenomics studies can be even smaller. Most analyzed sequences have two ORFs: the replication-associated protein (Rep, also referred to as the replication initiator protein) and capsid protein (Cp or Cap), with some isolates having had a third ORF experimentally verified, and some sequences having many hypothetical ORFs called that have not yet been studied in the lab.

Both cycloviruses and circoviruses have non-enveloped, icosahedral virions of 15-25nm encapsidating their circular, ssDNA genomes, but while members of Circovirus are found infecting or associated with mammals, birds and fish, cycloviruses have been found infecting or associated with mammals, birds and insects. Sequences assigned to Circovirus have ambisense genomes, with the Rep gene in sense, sequences in Cyclovirus typically are ambisense in the opposite orientation (Rep gene in anti-senese).

A great primer on Circoviridae

For more information about Circovirus:
ICTV report on circovirus
ExPASy ViralZone summary of circovirus Type species: Porcine circovirus 1 (NC_001792.2)

FOr more information about Cyclovirus:
ICTV report on cyclovirus
ExPASy ViralZone summary of cyclovirus Type species: Human-associated cyclovirus 8 (KF031466)

Classifier

>Demo MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI

• This classifier requires Rep protein sequence to be:
• Complete
• Unaligned
• in FASTA format

And has been trained on the following Genera:

• Circoviridae
• Circovirus
• Cyclovirus
• Nanoviridae
• Babuvirus
• Nanovirus
• Genomoviridae
• Gemycircularvirus
• Gemygorvirus
• Gemykibivirus
• Gemykolovirus
• Gemykrogvirus
• Gemyvongvirus
• Geminiviridae
• Becurtovirus
• Begomovirus
• Capulavirus
• Curtovirus
• Eragrovirus
• Grablovirus
• Mastrevirus
• Turncurtovirus
• Smacovirus

Contact

This site is under construction

Please be patient while we tidy up a bit!

Results

Results from Taxonomy prediction