diff options
| author | elavington <elavington@hotmail.com> | 2017-08-30 15:47:56 -0400 |
|---|---|---|
| committer | elavington <elavington@hotmail.com> | 2017-08-30 15:47:56 -0400 |
| commit | 00fec851a688f0f3b65e8619391b17a96d16799a (patch) | |
| tree | f87b275e149e7bcb5aae2c669a99e26193beb2ac /index.html | |
| parent | aec4083e9a37b58a2eb9584818d9dab740e89121 (diff) | |
| download | cressdna-00fec851a688f0f3b65e8619391b17a96d16799a.tar.gz cressdna-00fec851a688f0f3b65e8619391b17a96d16799a.zip | |
Commit changes
Diffstat (limited to 'index.html')
| -rw-r--r-- | index.html | 156 |
1 files changed, 146 insertions, 10 deletions
@@ -1,13 +1,149 @@ <!DOCTYPE html> + <html> - <head> - <title>CRESSDNA</title> - </head> -<*> -</*> - <body> - <h1>Circular Rep-Encoding Single Stranded DNA Viruses</h1> - <p>Part of the <a href='http://www.nsf.gov/pubs/2010/nsf10513/nsf10513.htm'>National Science Foundation's Assembling the Tree of Life</a>.</p> +<head> +<style> +* {box-sizing: border-box} +body {font-family: "Lato", sans-serif;} +/* Style the tab */ +div.tab { + float: left; + border: 1px solid #ccc; + background-color: #f1f1f1; + width: 20%; + height: 250px; +} +/* Style the buttons inside the tab */ +div.tab button { + display: block; + background-color: inherit; + color: black; + padding: 22px 16px; + width: 100%; + border: none; + outline: none; + text-align: left; + cursor: pointer; + transition: 0.3s; + font-size: 17px; +} +/* Change background color of buttons on hover */ +div.tab button:hover { + background-color: #ddd; +} +/* Create an active/current "tab button" class */ +div.tab button.active { + background-color: #1acefc; +} +/* Style the tab content */ +.tabcontent { + float: left; + padding: 0px 12px; + border: 1px solid #ccc; + width: 80%; + min-height: 250px; +} +</style> +</head> +<body> + +<p>Welcome to CRESSdna.org</p> + +<div class="tab"> + <button class="tablinks" onclick="openTab(event, 'Home')" id="defaultOpen">Home</button> + <button class="tablinks" onclick="openTab(event, 'Taxonomy')">Taxonomy</button> + <button class="tablinks" onclick="openTab(event, 'Contact')">Contact</button> + <button class="tablinks" onclick="openTab(event, 'Results')">Results</button> + </div> + +<div id="Home" class="tabcontent"> + <h3>Home</h3> + <p>Part of the <a href='http://www.nsf.gov/pubs/2010/nsf10513/nsf10513.htm'>National Science Foundation's Assembling the Tree of Life</a>.</p> <img src='nsf1.jpg' alt='Sponsored with a Grant from the National Science Foundation'> - </body> -</html> +</div> + +<div id="Taxonomy" class="tabcontent"> + <h3>Taxonomy</h3> + <form action="./cgi-bin/classifier.py" method="post"><br> + <textarea rows="4" cols="50" name="fasta" input type="submit"> +>Demo +MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI</textarea> + <br> + <input type="reset"> + <input type="submit"> +</form> + <p> + <ul> + <li>This classifier requires Rep protein sequence to be:</li> + <ul> + <li>Complete</li> + <li>Unaligned</li> + <li>in FASTA format</li> + </ul> + <p>And has been trained on the following Genera:</p> + <li>Circoviridae</li> + <ul> + <li>Circovirus</li> + <li>Cyclovirus</li> + </ul> + <li>Nanoviridae</li> + <ul> + <li>Babuvirus</li> + <li>Nanovirus</li> + </ul> + <li>Genomoviridae</li> + <ul> + <li>Gemycircularvirus</li> + <li>Gemygorvirus</li> + <li>Gemykibivirus</li> + <li>Gemykolovirus</li> + <li>Gemykrogvirus</li> + <li>Gemyvongvirus</li> + </ul> + <li>Geminiviridae</li> + <ul> + <li>Becurtovirus</li> + <li>Begomovirus</li> + <li>Capulavirus</li> + <li>Curtovirus</li> + <li>Eragrovirus</li> + <li>Grablovirus</li> + <li>Mastrevirus</li> + <li>Turncurtovirus</li> + </ul> + <li>Smacovirus</li> +</ul> </p> +</div> + + +<div id="Contact" class="tabcontent"> + <h3>Contact</h3> + <p>This site is under construction</p> + <p>Please be patient while we tidy up a bit!</p> +</div> + +<div id="Results" class="tabcontent"> + <h3>Results</h3> + <p>Results from Taxonomy prediction</p> +</div> + +<script> +function openTab(evt, tabTitle) { + var i, tabcontent, tablinks; + tabcontent = document.getElementsByClassName("tabcontent"); + for (i = 0; i < tabcontent.length; i++) { + tabcontent[i].style.display = "none"; + } + tablinks = document.getElementsByClassName("tablinks"); + for (i = 0; i < tablinks.length; i++) { + tablinks[i].className = tablinks[i].className.replace(" active", ""); + } + document.getElementById(tabTitle).style.display = "block"; + evt.currentTarget.className += " active"; +} +// Get the element with id="defaultOpen" and click on it +document.getElementById("defaultOpen").click(); +</script> + +</body> +</html> |
