diff options
| -rwxr-xr-x | bin/classifier.py | 35 | ||||
| -rw-r--r-- | index.html | 3 |
2 files changed, 20 insertions, 18 deletions
diff --git a/bin/classifier.py b/bin/classifier.py index 1e27758..e3150ee 100755 --- a/bin/classifier.py +++ b/bin/classifier.py @@ -74,12 +74,21 @@ predictions=clf.predict(X) # | results="""""" if "demo" in nameList: - results+="""<p>There seems to have been an error.<br>If you are expecting more than one prediction or - do not see the name you entered please try the submission form again, making sure that the input is in FASTA format.""" + results+="""<p>There seems to have been an error.<br>If you are expecting more than one prediction or do not see the name you entered please try the submission form again, making sure that the input is in FASTA format.<br>""" else: + results+=""" + <table> + <tr> + <th>Sequence Name</th> + <th>Length</th> + <th>Prediction</th> + </tr> + """ for k in len(seqList): results+="""<tr><td>{0}</td><td>{1}</td><td>{2}</td></tr>""".format(nameList[k],lenList[k],predictions[k]) - + results+=""" + </table> + """ #----------------------------------------------\ # Build output page \ @@ -169,16 +178,16 @@ body1=""" <div id="Home" class="tabcontent"> <h3>Home</h3> <p>Part of the <a href='http://www.nsf.gov/pubs/2010/nsf10513/nsf10513.htm'>National Science Foundation's Assembling the Tree of Life</a>.</p> - <img src='nsf1.jpg' alt='Sponsored with a Grant from the National Science Foundation'> + <img src='../nsf1.jpg' alt='Sponsored with a Grant from the National Science Foundation'> </div> <div id="Taxonomy" class="tabcontent"> <h3>Taxonomy</h3> - <p>Please enter only one word as the name(no space) and only one Rep sequence</p> - <form action="./cgi-bin/classifier.py" method="post"><br> - <input type="text" name="seqname" value="seqID"><br> - <textarea rows="4" cols="50" name="fasta" input type="submit"> -Enter ONE Rep protein sequence here...</textarea> + <form action="classifier.py" method="post"><br> + <textarea rows="4" cols="50" name="fasta" input type="submit"> +>Demo +MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI</textarea> +</textarea> <br> <input type="reset"> <input type="submit"> @@ -234,17 +243,11 @@ Enter ONE Rep protein sequence here...</textarea> <div id="Results" class="tabcontent"> <h3>Results</h3> <p>Results from Taxonomy prediction</p> - <table> - <tr> - <th>Sequence Name</th> - <th>Length</th> - <th>Prediction</th> - </tr> + """ #Page contents, second part (results fit between body1 and body2) body2=""" -</table> <p>This classifier will return the best fit of the submitted sequence to the training data.<br> Currently included in the training data:<br> <li>Circoviridae</li> @@ -65,8 +65,7 @@ div.tab button.active { <div id="Taxonomy" class="tabcontent"> <h3>Taxonomy</h3> <form action="./bin/classifier.py" method="post"><br> - <textarea rows="4" cols="50" name="fasta" input type="submit"> ->Demo + <textarea rows="4" cols="50" name="fasta" input type="submit">>Demo MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI</textarea> <br> <input type="reset"> |
