aboutsummaryrefslogtreecommitdiffstats
path: root/bin/classifier.py
diff options
context:
space:
mode:
Diffstat (limited to 'bin/classifier.py')
-rwxr-xr-xbin/classifier.py180
1 files changed, 92 insertions, 88 deletions
diff --git a/bin/classifier.py b/bin/classifier.py
index e3150ee..2766f08 100755
--- a/bin/classifier.py
+++ b/bin/classifier.py
@@ -1,47 +1,52 @@
-#!/home/erik/bin/python3.6
+#!/home/erik/bin/python3
#import packages to be used
+import cgi, cgitb
+import warnings
from sklearn.svm import SVC
from sklearn.feature_extraction.text import CountVectorizer
from sklearn.preprocessing import StandardScaler
from sklearn.externals import joblib
-import cgi, cgitb
-import warnings
-
-warnings.simplefilter("ignore", UserWarning)
+import re
+warnings.simplefilter("ignore", UserWarning)#ignore a joblib version warning
#----------------------------------------------\
# Parse the web-form information to variables \
# \_______________________________________________________
# |
-cgitb.enable()
+cgitb.enable(display=1, logdir="/var/www/html/bin/")
form=cgi.FieldStorage()
-alignment = str(form.getvalue('fasta'))
+alignment = form.getvalue('fasta')
if alignment.startswith(">"): #naive check for FASTA format
list=alignment.split(">")
- book={}
- for a in list:
- tempList=a.splitlines()
- nameLine=tempList.pop(0)
- name=nameLine.split(" ")[0]
- seq="".join(tempList)
- book[name]=seq
+ if list[0] == "":
+ list.pop(0)#get rid of the leading empty string
+
seqList=[]
lenList=[]
nameList=[]
- for i in book:
- nameList.append(i)
- seqList.append(book[i])
- lenList.append(str(len(book[i])))
-
+
+ for a in list:
+ tempList=a.split("\r\n")
+ if tempList[-1]=="":
+ tempList.pop(-1)#get rid of the trailing empty string
+
+ tempSeq=""
+ nameList.append(tempList[0])
+ for element in tempList[1:]:
+ tempSeq+=element
+
+ seqList.append(tempSeq)
+ lenList.append(str(len(tempSeq)))
+
if len(seqList)==0: #check for empty sequence list
seqList = ["MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI"]
- nameList=['demo']
+ nameList=['Demo']
lenList=[str(len(alignment[0]))]
-
+
else:
seqList = ["MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI"]
- nameList=['demo']
+ nameList=['Demo']
lenList=[str(len(alignment[0]))]
#--------------------------------------------------------------------------------------------------------+
@@ -54,41 +59,44 @@ else:
AAs=['a','c','d','e','f','g','h','i','k','l','m','n','p','q','r','s','t','v','w','y']
#load the classifier and scaler
-clf=joblib.load("SVM_linear_aa_clf.pkl")
-StSc=joblib.load("UniqRepsGemys_6089_StSCALER.pkl")
+clf=joblib.load("./SVM_linear_aa_clf.pkl")
+
+StSc=joblib.load("./UniqRepsGemys_6089_StSCALER.pkl")
+
cv=CountVectorizer(analyzer='char',ngram_range=(1,1),vocabulary=AAs)
#initialize text data vectorizer
dataVect=cv.transform(seqList)
-
+
#Scale the data to the training set
X=StSc.transform(dataVect.astype("float64"))
#make predictions for the original dataset
predictions=clf.predict(X)
-
+
#----------------------------------------------\
# Build HTML table of results \
# \_______________________________________________________
-# |
-results=""""""
-if "demo" in nameList:
- results+="""<p>There seems to have been an error.<br>If you are expecting more than one prediction or do not see the name you entered please try the submission form again, making sure that the input is in FASTA format.<br>"""
-else:
- results+="""
- <table>
- <tr>
- <th>Sequence Name</th>
- <th>Length</th>
- <th>Prediction</th>
- </tr>
- """
- for k in len(seqList):
- results+="""<tr><td>{0}</td><td>{1}</td><td>{2}</td></tr>""".format(nameList[k],lenList[k],predictions[k])
- results+="""
- </table>
- """
+#
+#results="<p> Entered Text Content Seq Name is {0} length {1}</p>".format(nameList,predictions)
+results=""
+results+="""
+<table>
+<tr>
+<th>Sequence Name</th>
+<th>Length</th>
+<th>Prediction</th>
+</tr>
+
+"""
+
+
+for k in range(len(nameList)):
+ results+="<tr><td>{0}</td><td>{1}</td><td>{2}</td></tr>".format(nameList[k],lenList[k],predictions[k])
+
+results+="</table>"
+
#----------------------------------------------\
# Build output page \
@@ -96,7 +104,8 @@ else:
# |
#build output page parts
#Header and CSS Style bits
-header="""<!DOCTYPE html>
+
+header="""Content-type:text/html
<html>
<head>
@@ -105,66 +114,64 @@ header="""<!DOCTYPE html>
body {font-family: "Lato", sans-serif;}
/* Style the tab */
div.tab {
- float: left;
- border: 1px solid #ccc;
- background-color: #f1f1f1;
- width: 20%;
- height: 250px;
+ float: left;
+ border: 1px solid #ccc;
+ background-color: #f1f1f1;
+ width: 20%;
+ height: 250px;
}
/* Style the buttons inside the tab */
div.tab button {
- display: block;
- background-color: inherit;
- color: black;
- padding: 22px 16px;
- width: 100%;
- border: none;
- outline: none;
- text-align: left;
- cursor: pointer;
- transition: 0.3s;
- font-size: 17px;
+ display: block;
+ background-color: inherit;
+ color: black;
+ padding: 22px 16px;
+ width: 100%;
+ border: none;
+ outline: none;
+ text-align: left;
+ cursor: pointer;
+ transition: 0.3s;
+ font-size: 17px;
}
/* Change background color of buttons on hover */
div.tab button:hover {
- background-color: #ddd;
+ background-color: #ddd;
}
/* Create an active/current "tab button" class */
div.tab button.active {
- background-color: #1acefc;
+ background-color: #1acefc;
}
/* Style the tab content */
.tabcontent {
- float: left;
- padding: 0px 12px;
- border: 1px solid #ccc;
- width: 80%;
- min-height: 250px;
+ float: left;
+ padding: 0px 12px;
+ border: 1px solid #ccc;
+ width: 80%;
+ min-height: 250px;
}
table {
- border-collapse: collapse;
- width: 80%;
+ border-collapse: collapse;
+ width: 80%;
}
th, td {
- text-align: left;
- padding: 8px;
+ text-align: left;
+ padding: 8px;
}
tr:nth-child(even){background-color: #f2f2f2}
th {
- background-color: #ff0000;
- color: white;
+ background-color: #ff0000;
+ color: white;
}
-
</style>
</head>
-"""
+"""
#Page contents, first part
-body1="""
-<body>
+body1="""<body>
<p>Welcome to CRESSdna.org</p>
@@ -173,7 +180,7 @@ body1="""
<button class="tablinks" onclick="openTab(event, 'Taxonomy')">Taxonomy</button>
<button class="tablinks" onclick="openTab(event, 'Contact')">Contact</button>
<button class="tablinks" onclick="openTab(event, 'Results')"id="defaultOpen">Results</button>
- </div>
+</div>
<div id="Home" class="tabcontent">
<h3>Home</h3>
@@ -236,8 +243,9 @@ MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHI
</div>
<div id="Contact" class="tabcontent">
<h3>Contact</h3>
- <p>Questions or comments? Send us an email:</p>
- <p>email At domain Dot something</p>
+ <p>This site is under construction</p>
+ <p>Please be patient while we tidy up a bit!</p>
+
</div>
<div id="Results" class="tabcontent">
@@ -247,8 +255,7 @@ MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHI
"""
#Page contents, second part (results fit between body1 and body2)
-body2="""
- <p>This classifier will return the best fit of the submitted sequence to the training data.<br>
+body2="""<p>This classifier will return the best fit of the submitted sequence to the training data.<br>
Currently included in the training data:<br>
<li>Circoviridae</li>
<ul>
@@ -307,14 +314,11 @@ document.getElementById("defaultOpen").click();
#close the Page
footer="""
-</html>
-"""
+</html>"""
#build the output page
page=header+body1+results+body2+footer
-
+
#send the output as html
-#output = page.format()
print (page)
-
quit()