aboutsummaryrefslogtreecommitdiffstats
path: root/bin
diff options
context:
space:
mode:
authorelavington <elavington@hotmail.com>2017-09-25 13:41:56 -0400
committerelavington <elavington@hotmail.com>2017-09-25 13:41:56 -0400
commit09826e4bd595872a61c85a7d7c013d81408ecfd8 (patch)
tree1a4edee353d4b9d94550465ddda17048a3f5f7c3 /bin
parent0bfbd73c5bfc838cde80594e1cd2f60eb1d7443c (diff)
downloadcressdna-09826e4bd595872a61c85a7d7c013d81408ecfd8.tar.gz
cressdna-09826e4bd595872a61c85a7d7c013d81408ecfd8.zip
Cleaned up classifier html output
Diffstat (limited to 'bin')
-rwxr-xr-xbin/classifier.py35
1 files changed, 19 insertions, 16 deletions
diff --git a/bin/classifier.py b/bin/classifier.py
index 1e27758..e3150ee 100755
--- a/bin/classifier.py
+++ b/bin/classifier.py
@@ -74,12 +74,21 @@ predictions=clf.predict(X)
# |
results=""""""
if "demo" in nameList:
- results+="""<p>There seems to have been an error.<br>If you are expecting more than one prediction or
- do not see the name you entered please try the submission form again, making sure that the input is in FASTA format."""
+ results+="""<p>There seems to have been an error.<br>If you are expecting more than one prediction or do not see the name you entered please try the submission form again, making sure that the input is in FASTA format.<br>"""
else:
+ results+="""
+ <table>
+ <tr>
+ <th>Sequence Name</th>
+ <th>Length</th>
+ <th>Prediction</th>
+ </tr>
+ """
for k in len(seqList):
results+="""<tr><td>{0}</td><td>{1}</td><td>{2}</td></tr>""".format(nameList[k],lenList[k],predictions[k])
-
+ results+="""
+ </table>
+ """
#----------------------------------------------\
# Build output page \
@@ -169,16 +178,16 @@ body1="""
<div id="Home" class="tabcontent">
<h3>Home</h3>
<p>Part of the <a href='http://www.nsf.gov/pubs/2010/nsf10513/nsf10513.htm'>National Science Foundation's Assembling the Tree of Life</a>.</p>
- <img src='nsf1.jpg' alt='Sponsored with a Grant from the National Science Foundation'>
+ <img src='../nsf1.jpg' alt='Sponsored with a Grant from the National Science Foundation'>
</div>
<div id="Taxonomy" class="tabcontent">
<h3>Taxonomy</h3>
- <p>Please enter only one word as the name(no space) and only one Rep sequence</p>
- <form action="./cgi-bin/classifier.py" method="post"><br>
- <input type="text" name="seqname" value="seqID"><br>
- <textarea rows="4" cols="50" name="fasta" input type="submit">
-Enter ONE Rep protein sequence here...</textarea>
+ <form action="classifier.py" method="post"><br>
+ <textarea rows="4" cols="50" name="fasta" input type="submit">
+>Demo
+MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI</textarea>
+</textarea>
<br>
<input type="reset">
<input type="submit">
@@ -234,17 +243,11 @@ Enter ONE Rep protein sequence here...</textarea>
<div id="Results" class="tabcontent">
<h3>Results</h3>
<p>Results from Taxonomy prediction</p>
- <table>
- <tr>
- <th>Sequence Name</th>
- <th>Length</th>
- <th>Prediction</th>
- </tr>
+
"""
#Page contents, second part (results fit between body1 and body2)
body2="""
-</table>
<p>This classifier will return the best fit of the submitted sequence to the training data.<br>
Currently included in the training data:<br>
<li>Circoviridae</li>