diff options
| author | elavington <elavington@hotmail.com> | 2017-09-25 11:43:53 -0400 |
|---|---|---|
| committer | elavington <elavington@hotmail.com> | 2017-09-25 11:43:53 -0400 |
| commit | 0a13a6387b7a9f70ae58fdcd7196b7c480be40bd (patch) | |
| tree | 99de444657a9712cf58bcecb93799a46ab3d1b16 /index.html | |
| parent | 47b146536121acc6ac8e3d847be2152500fe3167 (diff) | |
| download | cressdna-0a13a6387b7a9f70ae58fdcd7196b7c480be40bd.tar.gz cressdna-0a13a6387b7a9f70ae58fdcd7196b7c480be40bd.zip | |
Revised Folder contents and classifier code
Diffstat (limited to 'index.html')
| -rw-r--r-- | index.html | 4 |
1 files changed, 2 insertions, 2 deletions
@@ -3,7 +3,7 @@ <html> <head> <style> -* {box-sizing: border-box} +*{box-sizing: border-box;} body {font-family: "Lato", sans-serif;} /* Style the tab */ div.tab { @@ -64,7 +64,7 @@ div.tab button.active { <div id="Taxonomy" class="tabcontent"> <h3>Taxonomy</h3> - <form action="bin/classifier.py" method="post"><br> + <form action="./bin/classifier.py" method="post"><br> <textarea rows="4" cols="50" name="fasta" input type="submit"> >Demo MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI</textarea> |