diff options
| author | Brian Cully <bjc@kublai.com> | 2017-09-22 17:12:26 -0400 |
|---|---|---|
| committer | Brian Cully <bjc@kublai.com> | 2017-09-22 17:12:26 -0400 |
| commit | 47b146536121acc6ac8e3d847be2152500fe3167 (patch) | |
| tree | ebce6d8b8b833823330ab0092e86bc8d321113f7 /index.html | |
| parent | e387bd409e271a149692d45a952e6475f3b706be (diff) | |
| download | cressdna-47b146536121acc6ac8e3d847be2152500fe3167.tar.gz cressdna-47b146536121acc6ac8e3d847be2152500fe3167.zip | |
Fixup various CGI problems.
* Rename cgi-bin to bin, to bypass default cgi-bin alias.
* Change assignment to equality check in classifier.
* Add .htaccess file to bin dir to allow CGI execution.
* Point index.html form to bin.
Diffstat (limited to 'index.html')
| -rw-r--r-- | index.html | 2 |
1 files changed, 1 insertions, 1 deletions
@@ -64,7 +64,7 @@ div.tab button.active { <div id="Taxonomy" class="tabcontent"> <h3>Taxonomy</h3> - <form action="./cgi-bin/classifier.py" method="post"><br> + <form action="bin/classifier.py" method="post"><br> <textarea rows="4" cols="50" name="fasta" input type="submit"> >Demo MPSKKSGPQPHKRWVFTLNNPSEEEKNKIRELPISLFDYFVCGEEGLEEGRTAHLQGFANFAKKQTFNKVKWYFGARCHIEKAKGTDQQNKEYCSKEGHILIECGAPRNQGKRSDLSTAYFDYQQSGPPGMVLLNCCPSCRSSLSEDYYFAILEDCWRTINGGTRRPI</textarea> |
